PHACTR3 antibody (70R-2298)

Rabbit polyclonal PHACTR3 antibody raised against the C terminal of PHACTR3

Synonyms Polyclonal PHACTR3 antibody, Anti-PHACTR3 antibody, PHACTR-3, PHACTR 3, C20orf101 antibody, MGC117178 antibody, SCAPIN1 antibody, PHACTR 3 antibody, PHACTR3, PHACTR-3 antibody, H17739 antibody, Phosphatase And Actin Regulator 3 antibody
Specificity PHACTR3 antibody was raised against the C terminal of PHACTR3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
Assay Information PHACTR3 Blocking Peptide, catalog no. 33R-3947, is also available for use as a blocking control in assays to test for specificity of this PHACTR3 antibody

Images

Western Blot analysis using PHACTR3 antibody (70R-2298)

PHACTR3 antibody (70R-2298) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHACTR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PHACTR3 antibody (70R-2298) | PHACTR3 antibody (70R-2298) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors