PHF20L1 Blocking Peptide (33R-1031)

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF20L1 antibody, catalog no. 70R-8973

Synonyms PHF20L1 control peptide, PHF20L1 antibody Blocking Peptide, Anti-PHF20L1 Blocking Peptide, PHD finger protein 20-like 1 Blocking Peptide, CGI-72 Blocking Peptide, MGC64923 Blocking Peptide, PHF20L1, PHFL1-20, PHFL1 20, PHFL1-20 Blocking Peptide, PHFL1 20 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE
Molecular Weight 63 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHF20L1 is Involved in cell differentiation and/or proliferation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors