PHGDH antibody (70R-5255)

Rabbit polyclonal PHGDH antibody raised against the middle region of PHGDH

Synonyms Polyclonal PHGDH antibody, Anti-PHGDH antibody, PGDH antibody, SERA antibody, 3-PGDH antibody, MGC3017 antibody, PDG antibody, PGAD antibody, 3PGDH antibody, PGD antibody, Phosphoglycerate Dehydrogenase antibody
Specificity PHGDH antibody was raised against the middle region of PHGDH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF
Assay Information PHGDH Blocking Peptide, catalog no. 33R-1641, is also available for use as a blocking control in assays to test for specificity of this PHGDH antibody


Western Blot analysis using PHGDH antibody (70R-5255)

PHGDH antibody (70R-5255) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHGDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH; EC catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PHGDH antibody (70R-5255) | PHGDH antibody (70R-5255) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors