PHLDA2 antibody (70R-6017)

Rabbit polyclonal PHLDA2 antibody raised against the middle region of PHLDA2

Synonyms Polyclonal PHLDA2 antibody, Anti-PHLDA2 antibody, PHLDA-2 antibody, BRW1C antibody, IPL antibody, PHLDA2, BWR1C antibody, Pleckstrin Homology-Like Domain Family A Member 2 antibody, TSSC3 antibody, PHLDA 2 antibody, PHLDA 2, PHLDA-2, HLDA2 antibody
Specificity PHLDA2 antibody was raised against the middle region of PHLDA2
Cross Reactivity Human
Applications WB
Immunogen PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
Assay Information PHLDA2 Blocking Peptide, catalog no. 33R-7668, is also available for use as a blocking control in assays to test for specificity of this PHLDA2 antibody


Western Blot analysis using PHLDA2 antibody (70R-6017)

PHLDA2 antibody (70R-6017) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor and rhabdomyosarcoma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PHLDA2 antibody (70R-6017) | PHLDA2 antibody (70R-6017) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors