PHLDA3 antibody (70R-4228)

Rabbit polyclonal PHLDA3 antibody raised against the N terminal of PHLDA3

Synonyms Polyclonal PHLDA3 antibody, Anti-PHLDA3 antibody, Pleckstrin Homology-Like Domain Family A Member 3 antibody, PHLDA-3, PHLDA 3 antibody, PHLDA3, PHLDA 3, PHLDA-3 antibody, TIH1 antibody
Specificity PHLDA3 antibody was raised against the N terminal of PHLDA3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PHLDA3 antibody was raised using the N terminal of PHLDA3 corresponding to a region with amino acids LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC
Assay Information PHLDA3 Blocking Peptide, catalog no. 33R-5324, is also available for use as a blocking control in assays to test for specificity of this PHLDA3 antibody

Images

Western Blot analysis using PHLDA3 antibody (70R-4228)

PHLDA3 antibody (70R-4228) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHLDA3 is a p53/TP53-regulated repressor of Akt/AKT1 signaling. It represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PHLDA3 antibody (70R-4228) | PHLDA3 antibody (70R-4228) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors