PHYH antibody (70R-5259)

Rabbit polyclonal PHYH antibody raised against the middle region of PHYH

Synonyms Polyclonal PHYH antibody, Anti-PHYH antibody, PAHX antibody, PHYH1 antibody, Phytanoyl-Coa 2-Hydroxylase antibody, LN1 antibody, LNAP1 antibody, RD antibody
Specificity PHYH antibody was raised against the middle region of PHYH
Cross Reactivity Human
Applications WB
Immunogen PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI
Assay Information PHYH Blocking Peptide, catalog no. 33R-2503, is also available for use as a blocking control in assays to test for specificity of this PHYH antibody

Images

Western Blot analysis using PHYH antibody (70R-5259)

PHYH antibody (70R-5259) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHYH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PHYH antibody (70R-5259) | PHYH antibody (70R-5259) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors