PHYHIP antibody (70R-3248)

Rabbit polyclonal PHYHIP antibody raised against the N terminal of PHYHIP

Synonyms Polyclonal PHYHIP antibody, Anti-PHYHIP antibody, PAHX-AP antibody, Phytanoyl-Coa 2-Hydroxylase Interacting Protein antibody, KIAA0273 antibody, DYRK1AP3 antibody
Specificity PHYHIP antibody was raised against the N terminal of PHYHIP
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL
Assay Information PHYHIP Blocking Peptide, catalog no. 33R-4371, is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody


Western Blot analysis using PHYHIP antibody (70R-3248)

PHYHIP antibody (70R-3248) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHYHIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHYHIP interacts with PHYH suggests a role in the development of the central system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PHYHIP antibody (70R-3248) | PHYHIP antibody (70R-3248) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors