PI4K2B antibody (70R-3490)

Rabbit polyclonal PI4K2B antibody raised against the middle region of PI4K2B

Synonyms Polyclonal PI4K2B antibody, Anti-PI4K2B antibody, Phosphatidylinositol 4-Kinase Type 2 Beta antibody, PIK2B-4 antibody, PIK2B 4, PIK2B-4, PI4KIIB antibody, PIK2B 4 antibody, FLJ11105 antibody, PIK42B antibody, PI4K2B
Specificity PI4K2B antibody was raised against the middle region of PI4K2B
Cross Reactivity Human
Applications WB
Immunogen PI4K2B antibody was raised using the middle region of PI4K2B corresponding to a region with amino acids IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA
Assay Information PI4K2B Blocking Peptide, catalog no. 33R-3999, is also available for use as a blocking control in assays to test for specificity of this PI4K2B antibody

Images

Western Blot analysis using PI4K2B antibody (70R-3490)

PI4K2B antibody (70R-3490) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PI4K2B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphatidylinositol 4-kinases (PI4Ks) phosphorylate phosphatidylinositol to generate phosphatidylinositol 4-phosphate (PIP), an immediate precursor of several important signaling and scaffolding molecules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PI4K2B antibody (70R-3490) | PI4K2B antibody (70R-3490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors