PIGA antibody (70R-6607)

Rabbit polyclonal PIGA antibody raised against the middle region of PIGA

Synonyms Polyclonal PIGA antibody, Anti-PIGA antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class A antibody, PIG-A antibody, GPI3 antibody
Specificity PIGA antibody was raised against the middle region of PIGA
Cross Reactivity Human
Applications WB
Immunogen PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR
Assay Information PIGA Blocking Peptide, catalog no. 33R-8916, is also available for use as a blocking control in assays to test for specificity of this PIGA antibody

Images

Western Blot analysis using PIGA antibody (70R-6607)

PIGA antibody (70R-6607) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGA antibody (70R-6607) | PIGA antibody (70R-6607) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors