PIGF1 protein (30R-AP036)

Purified recombinant Human PIGF1 protein

Synonyms PGF protein, PIGF-1, PIGF 1, PIGF protein, PIGF 1 protein, PIGF1, Placenta Growth Factor-1 protein, PIGF-1 protein
Species Human
Protein Type Binding Protein
Applications User optimized

Specifications

Residues LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR
Expression System Sf-9 insect cells
Purity > 90% pure
Molecular Weight 19 kDa
Form & Buffer Lyophilized with carrier-protein (HSA) and can be reconstituted with 50 mM acetic acid or PBS.

Storage & Safety

Storage Store at -20 deg C until reconstitution. Following reconstitution product may be stored at 4 deg C in the short term. For long term storage aliquot and freeze at -20 deg C. Avoid repeated freeze/thaw cycles.

General Information

Biological Significance Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversal. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays.

References
Add a Paper

Zsolt Ablonczy, Craig E. Crosson

VEGF modulation of retinal pigment epithelium resistance

Experimental Eye Research

Volume: 85 Issue: 6 Page: 762-771 DOI: 10.1016/j.exer.2007.08.010

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $245.00
Size: 5 ug
OR
Shipping
View Our Distributors