PIGK antibody (70R-7113)

Rabbit polyclonal PIGK antibody raised against the N terminal of PIGK

Synonyms Polyclonal PIGK antibody, Anti-PIGK antibody, GPI8 antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class K antibody, MGC22559 antibody
Specificity PIGK antibody was raised against the N terminal of PIGK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV
Assay Information PIGK Blocking Peptide, catalog no. 33R-5803, is also available for use as a blocking control in assays to test for specificity of this PIGK antibody

Images

Western Blot analysis using PIGK antibody (70R-7113)

PIGK antibody (70R-7113) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGK antibody (70R-7113) | PIGK antibody (70R-7113) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors