PIGO antibody (70R-7301)

Rabbit polyclonal PIGO antibody raised against the N terminal of PIGO

Synonyms Polyclonal PIGO antibody, Anti-PIGO antibody, RP11-182N22.4 antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class O antibody, DKFZp434M222 antibody, FLJ00135 antibody, MGC20536 antibody, MGC3079 antibody
Specificity PIGO antibody was raised against the N terminal of PIGO
Cross Reactivity Human
Applications WB
Immunogen PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
Assay Information PIGO Blocking Peptide, catalog no. 33R-5039, is also available for use as a blocking control in assays to test for specificity of this PIGO antibody

Images

Western Blot analysis using PIGO antibody (70R-7301)

PIGO antibody (70R-7301) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGO antibody (70R-7301) | PIGO antibody (70R-7301) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors