PIGT antibody (70R-7466)

Rabbit polyclonal PIGT antibody raised against the C terminal of PIGT

Synonyms Polyclonal PIGT antibody, Anti-PIGT antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class T antibody, MGC8909 antibody, NDAP antibody, FLJ41596 antibody, CGI-06 antibody
Specificity PIGT antibody was raised against the C terminal of PIGT
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIGT antibody was raised using the C terminal of PIGT corresponding to a region with amino acids LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP
Assay Information PIGT Blocking Peptide, catalog no. 33R-5256, is also available for use as a blocking control in assays to test for specificity of this PIGT antibody

Images

Western Blot analysis using PIGT antibody (70R-7466)

PIGT antibody (70R-7466) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGT antibody (70R-7466) | PIGT antibody (70R-7466) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors