PIGW antibody (70R-6939)

Rabbit polyclonal PIGW antibody raised against the middle region of PIGW

Synonyms Polyclonal PIGW antibody, Anti-PIGW antibody, FLJ37433 antibody, Gwt1 antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class W antibody
Specificity PIGW antibody was raised against the middle region of PIGW
Cross Reactivity Human
Applications WB
Immunogen PIGW antibody was raised using the middle region of PIGW corresponding to a region with amino acids IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV
Assay Information PIGW Blocking Peptide, catalog no. 33R-3893, is also available for use as a blocking control in assays to test for specificity of this PIGW antibody

Images

Western Blot analysis using PIGW antibody (70R-6939)

PIGW antibody (70R-6939) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGW antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. PIGW acts in the third step of GPI biosynthesis and acylates the inositol ring of phosphatidylinositol.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGW antibody (70R-6939) | PIGW antibody (70R-6939) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors