PIK3R5 antibody (70R-4416)

Rabbit polyclonal PIK3R5 antibody raised against the N terminal of PIK3R5

Synonyms Polyclonal PIK3R5 antibody, Anti-PIK3R5 antibody, Phosphoinositide-3-Kinase Regulatory Subunit 5 antibody, P101-PI3K antibody, PIKR5-3, PIKR5-3 antibody, PIK3R5, F730038I15Rik antibody, PIKR5 3 antibody, PIKR5 3, FOAP-2 antibody
Specificity PIK3R5 antibody was raised against the N terminal of PIK3R5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIK3R5 antibody was raised using the N terminal of PIK3R5 corresponding to a region with amino acids HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS
Assay Information PIK3R5 Blocking Peptide, catalog no. 33R-3839, is also available for use as a blocking control in assays to test for specificity of this PIK3R5 antibody

Images

Western Blot analysis using PIK3R5 antibody (70R-4416)

PIK3R5 antibody (70R-4416) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIK3R5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIK3R5 antibody (70R-4416) | PIK3R5 antibody (70R-4416) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors