PIPOX antibody (70R-6986)

Rabbit polyclonal PIPOX antibody raised against the C terminal of PIPOX

Synonyms Polyclonal PIPOX antibody, Anti-PIPOX antibody, LPIPOX antibody, Pipecolic Acid Oxidase antibody
Specificity PIPOX antibody was raised against the C terminal of PIPOX
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
Assay Information PIPOX Blocking Peptide, catalog no. 33R-3119, is also available for use as a blocking control in assays to test for specificity of this PIPOX antibody

Images

Western Blot analysis using PIPOX antibody (70R-6986)

PIPOX antibody (70R-6986) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIPOX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIPOX antibody (70R-6986) | PIPOX antibody (70R-6986) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors