Pitx1 Blocking Peptide (33R-10356)

A synthetic peptide for use as a blocking control in assays to test for specificity of Pitx1 antibody, catalog no. 70R-7963

Synonyms Pitx1 control peptide, Pitx1 antibody Blocking Peptide, Anti-Pitx1 Blocking Peptide, paired-like homeodomain 1 Blocking Peptide, Bft Blocking Peptide, Pitx1, Pitx-1, Pitx 1, Pitx-1 Blocking Peptide, Pitx 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LCKGGYVPQFSGLVQPYEDVYAAAGYSYNNWAAKSLAPAPLSTKSFTFFN
Molecular Weight 34 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pitx1 is a paired-like homeobox transcription factor; transcription regulator of pituitary genes; genetic marker for nascent Rathke's pouch, precursor of anterior and intermediate lobes of pituitary gland .

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors