PKDREJ antibody (70R-5204)

Rabbit polyclonal PKDREJ antibody raised against the middle region of PKDREJ

Synonyms Polyclonal PKDREJ antibody, Anti-PKDREJ antibody, Polycystic Kidney Disease antibody, Polycystin And Rej Homolog antibody
Specificity PKDREJ antibody was raised against the middle region of PKDREJ
Cross Reactivity Human
Applications WB
Immunogen PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG
Assay Information PKDREJ Blocking Peptide, catalog no. 33R-3627, is also available for use as a blocking control in assays to test for specificity of this PKDREJ antibody

Images

Western Blot analysis using PKDREJ antibody (70R-5204)

PKDREJ antibody (70R-5204) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 254 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PKDREJ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PkDaREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PKDREJ antibody (70R-5204) | PKDREJ antibody (70R-5204) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors