PLA1A antibody (70R-5466)

Rabbit polyclonal PLA1A antibody raised against the middle region of PLA1A

Synonyms Polyclonal PLA1A antibody, Anti-PLA1A antibody, PLAA 1 antibody, PSPLA1 antibody, Phospholipase A1 Member A antibody, PLA1A, PS-PLA1 antibody, PLAA-1, PLAA 1, PLAA-1 antibody
Specificity PLA1A antibody was raised against the middle region of PLA1A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PLA1A antibody was raised using the middle region of PLA1A corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY
Assay Information PLA1A Blocking Peptide, catalog no. 33R-9022, is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody

Images

Western Blot analysis using PLA1A antibody (70R-5466)

PLA1A antibody (70R-5466) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLA1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLA1A antibody (70R-5466) | PLA1A antibody (70R-5466) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors