Plasminogen antibody (70R-5384)

Rabbit polyclonal Plasminogen antibody raised against the middle region of PLG

Synonyms Polyclonal Plasminogen antibody, Anti-Plasminogen antibody, PLG antibody, DKFZp779M0222 antibody
Specificity Plasminogen antibody was raised against the middle region of PLG
Cross Reactivity Human
Applications WB
Immunogen Plasminogen antibody was raised using the middle region of PLG corresponding to a region with amino acids LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
Assay Information Plasminogen Blocking Peptide, catalog no. 33R-5066, is also available for use as a blocking control in assays to test for specificity of this Plasminogen antibody


Western Blot analysis using Plasminogen antibody (70R-5384)

Plasminogen antibody (70R-5384) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin.

Add a Paper

Annie Giraud, Julie Dicristofaro, Catherine De Micco, Pierre-Jean Lejeune, Jocelyne Barbaria, Bernard Mallet

A plasminogen-like protein, present in the apical extracellular environment of thyroid epithelial cells, degrades thyroglobulin in vitro

Biochemical and Biophysical Research Communications

Volume: 338 Issue: 2 Page: 1000-1004 DOI: 10.1016/j.bbrc.2005.10.063

Annie Giraud, Odile Chabaud, Pierre-Jean Lejeune, Jocelyne Barbaria, Bernard Mallet

The plasminogen-like molecule apically secreted by epithelial thyroid cells is sulfated

Biochemical and Biophysical Research Communications

Volume: 346 Issue: 3 Page: 746-750 DOI: 10.1016/j.bbrc.2006.05.176


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Plasminogen antibody (70R-5384) | Plasminogen antibody (70R-5384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors