PLAT antibody (70R-4058)

Rabbit polyclonal PLAT antibody raised against the middle region of PLAT

Synonyms Polyclonal PLAT antibody, Anti-PLAT antibody, T-PA antibody, TPA antibody, Plasminogen Activator Tissue antibody, DKFZp686I03148 antibody
Specificity PLAT antibody was raised against the middle region of PLAT
Cross Reactivity Human
Applications WB
Immunogen PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR
Assay Information PLAT Blocking Peptide, catalog no. 33R-9356, is also available for use as a blocking control in assays to test for specificity of this PLAT antibody

Western Blot analysis using PLAT antibody (70R-4058)

PLAT antibody (70R-4058) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PLAT antibody (70R-4058) | PLAT antibody (70R-4058) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors