PLCB1 antibody (70R-5669)

Rabbit polyclonal PLCB1 antibody

Synonyms Polyclonal PLCB1 antibody, Anti-PLCB1 antibody, Phospholipase C Beta 1 antibody, PLCB-1 antibody, Phosphoinositide-Specific antibody, PLCB 1 antibody, PI-PLC antibody, PLCB 1, PLC-I antibody, PLCB-1, FLJ45792 antibody, PLC-154 antibody, PLCB1
Cross Reactivity Human, Mouse
Applications WB
Immunogen PLCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT
Assay Information PLCB1 Blocking Peptide, catalog no. 33R-2278, is also available for use as a blocking control in assays to test for specificity of this PLCB1 antibody

Images

Western Blot analysis using PLCB1 antibody (70R-5669)

PLCB1 antibody (70R-5669) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 134 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLCB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in intracellular transduction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLCB1 antibody (70R-5669) | PLCB1 antibody (70R-5669) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors