PLD3 antibody (70R-6831)

Rabbit polyclonal PLD3 antibody raised against the N terminal of PLD3

Synonyms Polyclonal PLD3 antibody, Anti-PLD3 antibody, PLD-3 antibody, PLD 3 antibody, HU-K4 antibody, PLD-3, PLD3, PLD 3, Phospholipase D Family Member 3 antibody
Specificity PLD3 antibody was raised against the N terminal of PLD3
Cross Reactivity Human,Mouse
Applications WB
Immunogen PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE
Assay Information PLD3 Blocking Peptide, catalog no. 33R-10033, is also available for use as a blocking control in assays to test for specificity of this PLD3 antibody

Images

Western Blot analysis using PLD3 antibody (70R-6831)

PLD3 antibody (70R-6831) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLD3 antibody (70R-6831) | PLD3 antibody (70R-6831) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors