PLEK antibody (70R-5839)

Rabbit polyclonal PLEK antibody raised against the N terminal of PLEK

Synonyms Polyclonal PLEK antibody, Anti-PLEK antibody, Pleckstrin antibody, P47 antibody, FLJ27168 antibody
Specificity PLEK antibody was raised against the N terminal of PLEK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL
Assay Information PLEK Blocking Peptide, catalog no. 33R-5943, is also available for use as a blocking control in assays to test for specificity of this PLEK antibody

Images

Western Blot analysis using PLEK antibody (70R-5839)

PLEK antibody (70R-5839) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLEK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLEK is a major protein kinase C substrate of platelets, its exact function is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLEK antibody (70R-5839) | PLEK antibody (70R-5839) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors