PLEKHA1 antibody (70R-3873)

Rabbit polyclonal PLEKHA1 antibody raised against the N terminal of PLEKHA1

Synonyms Polyclonal PLEKHA1 antibody, Anti-PLEKHA1 antibody, PLEKHA-1 antibody, Pleckstrin Homology Domain Containing Family A Member 1 antibody, PLEKHA 1 antibody, PLEKHA 1, PLEKHA-1, TAPP1 antibody, PLEKHA1
Specificity PLEKHA1 antibody was raised against the N terminal of PLEKHA1
Cross Reactivity Human
Applications WB
Immunogen PLEKHA1 antibody was raised using the N terminal of PLEKHA1 corresponding to a region with amino acids LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
Assay Information PLEKHA1 Blocking Peptide, catalog no. 33R-5226, is also available for use as a blocking control in assays to test for specificity of this PLEKHA1 antibody


Western Blot analysis using PLEKHA1 antibody (70R-3873)

PLEKHA1 antibody (70R-3873) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLEKHA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLEKHA1 binds specifically to phosphatidylinositol-3,4-diphosphate (PtdIns3,4P2), but not to other phosphoinositides. PLEKHA1 may recruit other proteins to the plasma membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLEKHA1 antibody (70R-3873) | PLEKHA1 antibody (70R-3873) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors