PLEKHH2 antibody (70R-3507)

Rabbit polyclonal PLEKHH2 antibody

Synonyms Polyclonal PLEKHH2 antibody, Anti-PLEKHH2 antibody, KIAA2028 antibody, PLEKHH2, PLEKHH1L antibody, PLEKHH-2 antibody, PLEKHH 2 antibody, Pleckstrin Homology Domain Containing Family H antibody, PLEKHH-2, PLEKHH 2
Cross Reactivity Human,Mouse
Applications WB
Immunogen PLEKHH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
Assay Information PLEKHH2 Blocking Peptide, catalog no. 33R-9995, is also available for use as a blocking control in assays to test for specificity of this PLEKHH2 antibody

Images

Immunohistochemical staining using PLEKHH2 antibody (70R-3507)

PLEKHH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 168 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLEKHH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a single-pass membrane protein. The exact function of PLEKHH2 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PLEKHH2 antibody (70R-3507) | PLEKHH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PLEKHH2 antibody (70R-3507) | PLEKHH2 antibody (70R-3507) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors