Plexin A2 antibody (70R-6314)

Rabbit polyclonal Plexin A2 antibody raised against the N terminal of PLXNA2

Synonyms Polyclonal Plexin A2 antibody, Anti-Plexin A2 antibody, Plexin A 2 antibody, FLJ30634 antibody, Plexin A-2 antibody, PLXNA2 antibody, FLJ11751 antibody, Plexin A2, Plexin A-2, KIAA0463 antibody, OCT antibody, Plexin A 2, PLXN2 antibody
Specificity Plexin A2 antibody was raised against the N terminal of PLXNA2
Cross Reactivity Human,Mouse
Applications WB
Immunogen Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Assay Information Plexin A2 Blocking Peptide, catalog no. 33R-8901, is also available for use as a blocking control in assays to test for specificity of this Plexin A2 antibody

Images

Western Blot analysis using Plexin A2 antibody (70R-6314)

Plexin A2 antibody (70R-6314) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 211 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLXNA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognised by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Plexin A2 antibody (70R-6314) | Plexin A2 antibody (70R-6314) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors