PLOD2 antibody (70R-5438)

Rabbit polyclonal PLOD2 antibody raised against the middle region of PLOD2

Synonyms Polyclonal PLOD2 antibody, Anti-PLOD2 antibody, TLH antibody, PLOD-2, LH2 antibody, PLOD-2 antibody, PLOD 2 antibody, Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 antibody, PLOD 2, PLOD2
Specificity PLOD2 antibody was raised against the middle region of PLOD2
Cross Reactivity Human,Rat
Applications WB
Immunogen PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
Assay Information PLOD2 Blocking Peptide, catalog no. 33R-4019, is also available for use as a blocking control in assays to test for specificity of this PLOD2 antibody

Images

Western Blot analysis using PLOD2 antibody (70R-5438)

PLOD2 antibody (70R-5438) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLOD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLOD2 antibody (70R-5438) | PLOD2 antibody (70R-5438) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors