PLP1 antibody (70R-7002)

Rabbit polyclonal PLP1 antibody raised against the middle region of PLP1

Synonyms Polyclonal PLP1 antibody, Anti-PLP1 antibody, MMPL antibody, PLP/DM20 antibody, PLP1, PLP-1, PLP antibody, SPG2 antibody, PLP 1, PMD antibody, PLP-1 antibody, PLP 1 antibody, Proteolipid Protein 1 antibody
Specificity PLP1 antibody was raised against the middle region of PLP1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PLP1 antibody was raised using the middle region of PLP1 corresponding to a region with amino acids IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ
Assay Information PLP1 Blocking Peptide, catalog no. 33R-4219, is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Images

Western Blot analysis using PLP1 antibody (70R-7002)

PLP1 antibody (70R-7002) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLP1 antibody (70R-7002) | PLP1 antibody (70R-7002) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors