PLSCR1 antibody (70R-4069)

Rabbit polyclonal PLSCR1 antibody raised against the N terminal of PLSCR1

Synonyms Polyclonal PLSCR1 antibody, Anti-PLSCR1 antibody, PLSCR1, PLSCR-1, PLSCR 1, Phospholipid Scramblase 1 antibody, MMTRA1B antibody, PLSCR 1 antibody, PLSCR-1 antibody
Specificity PLSCR1 antibody was raised against the N terminal of PLSCR1
Cross Reactivity Human
Applications WB
Immunogen PLSCR1 antibody was raised using the N terminal of PLSCR1 corresponding to a region with amino acids MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP
Assay Information PLSCR1 Blocking Peptide, catalog no. 33R-5844, is also available for use as a blocking control in assays to test for specificity of this PLSCR1 antibody

Images

Western Blot analysis using PLSCR1 antibody (70R-4069)

PLSCR1 antibody (70R-4069) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLSCR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLSCR1 antibody (70R-4069) | PLSCR1 antibody (70R-4069) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors