PLSCR3 antibody (70R-1990)

Rabbit polyclonal PLSCR3 antibody raised against the middle region of PLSCR3

Synonyms Polyclonal PLSCR3 antibody, Anti-PLSCR3 antibody, PLSCR 3, PLSCR3, PLSCR 3 antibody, Phospholipid Scramblase 3 antibody, PLSCR-3 antibody, PLSCR-3
Specificity PLSCR3 antibody was raised against the middle region of PLSCR3
Cross Reactivity Human
Applications WB
Immunogen PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV
Assay Information PLSCR3 Blocking Peptide, catalog no. 33R-3187, is also available for use as a blocking control in assays to test for specificity of this PLSCR3 antibody

Images

Western Blot analysis using PLSCR3 antibody (70R-1990)

PLSCR3 antibody (70R-1990) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLSCR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLSCR3 antibody (70R-1990) | PLSCR3 antibody (70R-1990) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors