PLUNC antibody (70R-5913)

Rabbit polyclonal PLUNC antibody raised against the middle region of PLUNC

Synonyms Polyclonal PLUNC antibody, Anti-PLUNC antibody, SPLUNC1 antibody, Palate Lung And Nasal Epithelium Carcinoma Associated antibody, LUNX antibody, SPURT antibody, NASG antibody, bA49G10.5 antibody
Specificity PLUNC antibody was raised against the middle region of PLUNC
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL
Assay Information PLUNC Blocking Peptide, catalog no. 33R-3412, is also available for use as a blocking control in assays to test for specificity of this PLUNC antibody

Images

Western Blot analysis using PLUNC antibody (70R-5913)

PLUNC antibody (70R-5913) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLUNC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLUNC antibody (70R-5913) | PLUNC antibody (70R-5913) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors