PNKP antibody (70R-4477)

Rabbit polyclonal PNKP antibody raised against the N terminal of PNKP

Synonyms Polyclonal PNKP antibody, Anti-PNKP antibody, Polynucleotide Kinase 3'-Phosphatase antibody, PNK antibody
Specificity PNKP antibody was raised against the N terminal of PNKP
Cross Reactivity Human
Applications WB
Immunogen PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ
Assay Information PNKP Blocking Peptide, catalog no. 33R-6026, is also available for use as a blocking control in assays to test for specificity of this PNKP antibody


Western Blot analysis using PNKP antibody (70R-4477)

PNKP antibody (70R-4477) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNKP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNKP antibody (70R-4477) | PNKP antibody (70R-4477) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors