PNMA1 antibody (70R-2057)

Rabbit polyclonal PNMA1 antibody raised against the middle region of PNMA1

Synonyms Polyclonal PNMA1 antibody, Anti-PNMA1 antibody, PNMA-1 antibody, PNMA 1, Paraneoplastic Antigen Ma1 antibody, PNMA 1 antibody, PNMA1, PNMA-1, MA1 antibody
Specificity PNMA1 antibody was raised against the middle region of PNMA1
Cross Reactivity Human
Applications WB
Immunogen PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids KSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR
Assay Information PNMA1 Blocking Peptide, catalog no. 33R-4658, is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody


Western Blot analysis using PNMA1 antibody (70R-2057)

PNMA1 antibody (70R-2057) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNMA1 antibody (70R-2057) | PNMA1 antibody (70R-2057) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors