PNN antibody (70R-6054)

Rabbit polyclonal PNN antibody raised against the N terminal of PNN

Synonyms Polyclonal PNN antibody, Anti-PNN antibody, DRS antibody, pinin antibody, Pinin Desmosome Associated Protein antibody, SDK3 antibody, memA antibody
Specificity PNN antibody was raised against the N terminal of PNN
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
Assay Information PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody

Images

Western Blot analysis using PNN antibody (70R-6054)

PNN antibody (70R-6054) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PNN antibody (70R-6054) | PNN antibody (70R-6054) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors