PNOC antibody (70R-6212)

Rabbit polyclonal PNOC antibody raised against the middle region of PNOC

Synonyms Polyclonal PNOC antibody, Anti-PNOC antibody, Prepronociceptin antibody, PPNOC antibody
Specificity PNOC antibody was raised against the middle region of PNOC
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PNOC antibody was raised using the middle region of PNOC corresponding to a region with amino acids EQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQY
Assay Information PNOC Blocking Peptide, catalog no. 33R-2660, is also available for use as a blocking control in assays to test for specificity of this PNOC antibody

Images

Western Blot analysis using PNOC antibody (70R-6212)

PNOC antibody (70R-6212) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNOC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. PNOC may be involved in neuronal differentiation and development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PNOC antibody (70R-6212) | PNOC antibody (70R-6212) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors