PNPLA5 antibody (70R-1126)

Rabbit polyclonal PNPLA5 antibody raised against the N terminal of PNPLA5

Synonyms Polyclonal PNPLA5 antibody, Anti-PNPLA5 antibody, PNPLA5, dJ388M5 antibody, PNPLA 5 antibody, 4833426H19Rik antibody, PNPLA 5, Patatin-Like Phospholipase Domain Containing 5 antibody, PNPLA-5, GS2L antibody, PNPLA-5 antibody, dJ388M5.4 antibody
Specificity PNPLA5 antibody was raised against the N terminal of PNPLA5
Cross Reactivity Human
Applications WB
Immunogen PNPLA5 antibody was raised using the N terminal of PNPLA5 corresponding to a region with amino acids LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL
Assay Information PNPLA5 Blocking Peptide, catalog no. 33R-5438, is also available for use as a blocking control in assays to test for specificity of this PNPLA5 antibody

Images

Western Blot analysis using PNPLA5 antibody (70R-1126)

PNPLA5 antibody (70R-1126) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PNPLA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.Human patatin-like phospholipases, such as PNPLA5, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PNPLA5 antibody (70R-1126) | PNPLA5 antibody (70R-1126) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors