PNPT1 antibody (70R-4670)

Rabbit polyclonal PNPT1 antibody raised against the middle region of PNPT1

Synonyms Polyclonal PNPT1 antibody, Anti-PNPT1 antibody, DKFZp762K1914 antibody, Polyribonucleotide Nucleotidyltransferase 1 antibody, old-35 antibody, PNPT 1, PNPT1, PNPT-1 antibody, PNPT-1, PNPT 1 antibody, OLD35 antibody, PNPASE antibody
Specificity PNPT1 antibody was raised against the middle region of PNPT1
Cross Reactivity Human
Applications WB
Immunogen PNPT1 antibody was raised using the middle region of PNPT1 corresponding to a region with amino acids CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
Assay Information PNPT1 Blocking Peptide, catalog no. 33R-1698, is also available for use as a blocking control in assays to test for specificity of this PNPT1 antibody


Immunohistochemical staining using PNPT1 antibody (70R-4670)

PNPT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNPT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PNPT1 antibody (70R-4670) | PNPT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PNPT1 antibody (70R-4670) | PNPT1 antibody (70R-4670) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors