Podoplanin antibody (70R-6816)

Rabbit polyclonal Podoplanin antibody raised against the N terminal of PDPN

Synonyms Polyclonal Podoplanin antibody, Anti-Podoplanin antibody, T1A-2 antibody, GP36 antibody, GP40 antibody, T1A antibody, PA2.26 antibody, PDPN antibody, HT1A-1 antibody, Gp38 antibody, OTS8 antibody
Specificity Podoplanin antibody was raised against the N terminal of PDPN
Cross Reactivity Human
Applications IHC, WB
Immunogen Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
Assay Information Podoplanin Blocking Peptide, catalog no. 33R-2420, is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody

Images

Immunohistochemical staining using Podoplanin antibody (70R-6816)

Podoplanin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDPN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Podoplanin antibody (70R-6816) | Podoplanin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using Podoplanin antibody (70R-6816) | Podoplanin antibody (70R-6816) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors