PODXL antibody (70R-6251)

Rabbit polyclonal PODXL antibody raised against the middle region of PODXL

Synonyms Polyclonal PODXL antibody, Anti-PODXL antibody, MGC138240 antibody, Podocalyxin-Like antibody, PCLP antibody, Gp200 antibody
Specificity PODXL antibody was raised against the middle region of PODXL
Cross Reactivity Human
Applications WB
Immunogen PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
Assay Information PODXL Blocking Peptide, catalog no. 33R-6983, is also available for use as a blocking control in assays to test for specificity of this PODXL antibody

Images

Immunohistochemical staining using PODXL antibody (70R-6251)

PODXL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PODXL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PODXL antibody (70R-6251) | PODXL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PODXL antibody (70R-6251) | PODXL antibody (70R-6251) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors