POLB antibody (70R-5581)

Rabbit polyclonal POLB antibody

Synonyms Polyclonal POLB antibody, Anti-POLB antibody, Polymerase (DNA directed) beta antibody, MGC125976 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML
Assay Information POLB Blocking Peptide, catalog no. 33R-3482, is also available for use as a blocking control in assays to test for specificity of this POLB antibody


Western Blot analysis using POLB antibody (70R-5581)

POLB antibody (70R-5581) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using POLB antibody (70R-5581) | POLB antibody (70R-5581) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors