POLD2 antibody (70R-5521)

Rabbit polyclonal POLD2 antibody

Synonyms Polyclonal POLD2 antibody, Anti-POLD2 antibody, POLD2, POLD 2, Polymerase (DNA directed) delta 2 regulatory subunit antibody, POLD 2 antibody, POLD-2, POLD-2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT
Assay Information POLD2 Blocking Peptide, catalog no. 33R-5355, is also available for use as a blocking control in assays to test for specificity of this POLD2 antibody


Western Blot analysis using POLD2 antibody (70R-5521)

POLD2 antibody (70R-5521) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a DNA polymerase delta complex, it is involved in DNA replication and repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using POLD2 antibody (70R-5521) | POLD2 antibody (70R-5521) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors