POLDIP3 antibody (70R-4847)

Rabbit polyclonal POLDIP3 antibody

Synonyms Polyclonal POLDIP3 antibody, Anti-POLDIP3 antibody, Polymerase (DNA directed) delta interacting protein 3 antibody, POLDIP 3 antibody, KIAA1649 antibody, POLDIP3, PDIP46 antibody, POLDIP-3, POLDIP 3, SKAR antibody, POLDIP-3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES
Assay Information POLDIP3 Blocking Peptide, catalog no. 33R-1855, is also available for use as a blocking control in assays to test for specificity of this POLDIP3 antibody


Immunohistochemical staining using POLDIP3 antibody (70R-4847)

POLDIP3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLDIP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using POLDIP3 antibody (70R-4847) | POLDIP3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using POLDIP3 antibody (70R-4847) | POLDIP3 antibody (70R-4847) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors