POLK antibody (70R-5522)

Rabbit polyclonal POLK antibody

Synonyms Polyclonal POLK antibody, Anti-POLK antibody, DINP antibody, Polymerase (DNA directed) kappa antibody, POLQ antibody, DINB1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL
Assay Information POLK Blocking Peptide, catalog no. 33R-4442, is also available for use as a blocking control in assays to test for specificity of this POLK antibody

Images

Western Blot analysis using POLK antibody (70R-5522)

POLK antibody (70R-5522) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLK antibody (70R-5522) | POLK antibody (70R-5522) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors