POLR1E antibody (70R-3384)

Rabbit polyclonal POLR1E antibody

Synonyms Polyclonal POLR1E antibody, Anti-POLR1E antibody, POLRE 1, POLR1E, PAF53 antibody, POLRE 1 antibody, POLRE-1, PRAF1 antibody, RP11-405L18.3 antibody, RNA Polymerase IE antibody, POLRE-1 antibody, FLJ13390 antibody, FLJ13970 antibody, Rna I Polypeptide E 53Kda antibody
Cross Reactivity Human
Applications WB
Immunogen POLR1E antibody was raised using a synthetic peptide corresponding to a region with amino acids SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL
Assay Information POLR1E Blocking Peptide, catalog no. 33R-8675, is also available for use as a blocking control in assays to test for specificity of this POLR1E antibody

Images

Western Blot analysis using POLR1E antibody (70R-3384)

POLR1E antibody (70R-3384) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR1E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLR1E antibody (70R-3384) | POLR1E antibody (70R-3384) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors