POLR3H antibody (70R-2134)

Rabbit polyclonal POLR3H antibody raised against the middle region of POLR3H

Synonyms Polyclonal POLR3H antibody, Anti-POLR3H antibody, POLRH-3, POLR3H, RPC8 antibody, MGC111097 antibody, POLRH 3, KIAA1665 antibody, MGC29654 antibody, POLRH 3 antibody, POLRH-3 antibody, RNA Polymerase III antibody
Specificity POLR3H antibody was raised against the middle region of POLR3H
Cross Reactivity Human
Applications WB
Immunogen POLR3H antibody was raised using the middle region of POLR3H corresponding to a region with amino acids AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL
Assay Information POLR3H Blocking Peptide, catalog no. 33R-1242, is also available for use as a blocking control in assays to test for specificity of this POLR3H antibody

Images

Western Blot analysis using POLR3H antibody (70R-2134)

POLR3H antibody (70R-2134) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3H antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLR3H antibody (70R-2134) | POLR3H antibody (70R-2134) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors