POLS antibody (70R-5580)

Rabbit polyclonal POLS antibody

Synonyms Polyclonal POLS antibody, Anti-POLS antibody, TRF4-1 antibody, LAK-1 antibody, TRF4 antibody, Polymerase (DNA directed) sigma antibody, POLK antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLS antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK
Assay Information POLS Blocking Peptide, catalog no. 33R-9878, is also available for use as a blocking control in assays to test for specificity of this POLS antibody

Images

Western Blot analysis using POLS antibody (70R-5580)

POLS antibody (70R-5580) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLS antibody (70R-5580) | POLS antibody (70R-5580) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors