POMT1 antibody (70R-6979)

Rabbit polyclonal POMT1 antibody raised against the middle region of POMT1

Synonyms Polyclonal POMT1 antibody, Anti-POMT1 antibody, Protein-O-Mannosyltransferase 1 antibody, POMT-1 antibody, POMT-1, FLJ37239 antibody, RT antibody, POMT 1 antibody, POMT1, LGMD2K antibody, POMT 1
Specificity POMT1 antibody was raised against the middle region of POMT1
Cross Reactivity Human
Applications WB
Immunogen POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL
Assay Information POMT1 Blocking Peptide, catalog no. 33R-5473, is also available for use as a blocking control in assays to test for specificity of this POMT1 antibody

Images

Western Blot analysis using POMT1 antibody (70R-6979)

POMT1 antibody (70R-6979) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 82 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POMT1 antibody (70R-6979) | POMT1 antibody (70R-6979) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors