POMT2 antibody (70R-6997)

Rabbit polyclonal POMT2 antibody raised against the middle region of POMT2

Synonyms Polyclonal POMT2 antibody, Anti-POMT2 antibody, POMT-2 antibody, POMT2, POMT 2 antibody, FLJ22309 antibody, POMT-2, POMT 2, DKFZp686G10254 antibody, Protein-O-Mannosyltransferase 2 antibody
Specificity POMT2 antibody was raised against the middle region of POMT2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
Assay Information POMT2 Blocking Peptide, catalog no. 33R-1266, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Images

Western Blot analysis using POMT2 antibody (70R-6997)

POMT2 antibody (70R-6997) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POMT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POMT2 is an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S. cerevisiae.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POMT2 antibody (70R-6997) | POMT2 antibody (70R-6997) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors