PON1 antibody (70R-5362)

Rabbit polyclonal PON1 antibody raised against the C terminal of PON1

Synonyms Polyclonal PON1 antibody, Anti-PON1 antibody, PON 1, ESA antibody, PON1, Paraoxonase 1 antibody, PON antibody, PON 1 antibody, PON-1, PON-1 antibody
Specificity PON1 antibody was raised against the C terminal of PON1
Cross Reactivity Human
Applications WB
Immunogen PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA
Assay Information PON1 Blocking Peptide, catalog no. 33R-1504, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody


Western Blot analysis using PON1 antibody (70R-5362)

PON1 antibody (70R-5362) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PON1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PON1 antibody (70R-5362) | PON1 antibody (70R-5362) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors